PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00832.1.g00060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27250.9 Da    PI: 8.8322
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00832.1.g00060.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13e-1898152256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ ++tkeq   Le+ F+++++++ +++  LA++l+L  rqV vWFqNrRa+ k
  Zpz_sc00832.1.g00060.1.am.mk  98 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALANQLNLRPRQVEVWFQNRRARTK 152
                                   78889************************************************98 PP

2HD-ZIP_I/II124.84.1e-4098186189
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+dye Lkr++++l+een++L+
  Zpz_sc00832.1.g00060.1.am.mk  98 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALANQLNLRPRQVEVWFQNRRARTKLKQTEVDYELLKRCCETLTEENRNLH 178
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLre 89 
                                   +e  +Lr+
  Zpz_sc00832.1.g00060.1.am.mk 179 RELLQLRA 186
                                   ******94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-1982155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-1885153IPR009057Homeodomain-like
PROSITE profilePS5007116.97394154IPR001356Homeobox domain
SMARTSM003892.0E-1596158IPR001356Homeobox domain
CDDcd000861.38E-1598155No hitNo description
PfamPF000461.3E-1598152IPR001356Homeobox domain
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
SMARTSM003404.4E-17154197IPR003106Leucine zipper, homeobox-associated
PfamPF021831.7E-9154187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEHEDVGLAL GLSLSSGHHG PKERRPSPST QLRALEPSLS LSVKADDGSQ TAQVRPLIGA  60
VKRELPVEED EYGPMDTAFY SAASPAAAAD DDEGCNSRKK LRLTKEQSAL LEDRFKEHST  120
LNPKQKVALA NQLNLRPRQV EVWFQNRRAR TKLKQTEVDY ELLKRCCETL TEENRNLHRE  180
LLQLRALTHP HRAAFFMPAT ALSVCPSCER LAGAPSATAV VADRQPKAAG TRRAAPLFST  240
FTKSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196102SRKKLRL
2146154RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983488.11e-117PREDICTED: homeobox-leucine zipper protein HOX15-like
SwissprotA2Z4C42e-78HOX15_ORYSI; Homeobox-leucine zipper protein HOX15
TrEMBLK4AE821e-117K4AE82_SETIT; Uncharacterized protein
STRINGSi037189m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.16e-57HD-ZIP family protein